ripoffreport.com rapport :   Visitez le site

Données techniques du ripoffreport.com

Geo IP vous fournit comme la latitude, la longitude et l'ISP (Internet Service Provider) etc. informations. Notre service GeoIP a trouvé l'hôte ripoffreport.com.Actuellement, hébergé dans United States et son fournisseur de services est CloudFlare Inc. .

the related websites

domaine	Titre
ripoffreport.com	scams, reviews, complaints, lawsuits and frauds. file a report, post your review
private-complaints.com	scam, reviews and complaints on businesses, products and services / scams, compl
complaintsboard.com	complaints board – complaints and reviews
teatoxreviews.org	teatox reviews.org | product reviews | best buys | scams
rippedoffonline.com	rip offs, reports, consumer reports, complaints and scams - ripped off online
usacomplaints.com	complaints and reviews
scamgroup.com	businesses you can't trust! scams, frauds, reviews
greeceplaces.me	places on greece map, 171 reviews and complaints - worldplaces
measuredup.com	customer service reviews - consumer complaints
dietpillswatchdog.com	Diet Pills Watchdog Reviews Best Buys Scams
checkbca.org	business consumer alliance - reviews, complaints and ratings
pissedconsumer.com	online reviews and complaints platform - pissed consumer
revdex.com	business services reviews, complaints & information | revdex.com
thedatingjudge.com	online dating reviews & exposing dating scams
testoripxsupplement.com	transvaginal & hernia mesh lawsuits & settlements

associationdedefensedesvictimesdelaventepyramidale.over-blog.com 

Analyse d'en-tête HTTP

Les informations d'en-tête HTTP font partie du protocole HTTP que le navigateur d'un utilisateur envoie à appelé cloudflare contenant les détails de ce que le navigateur veut et acceptera de nouveau du serveur Web.

DNS

HtmlToText

notice! those consumers located in the european union , effective 5/24/2018 due to the gdpr , citizens of any gdpr applicable country or anyone sitting in, or operating from, such country are prohibited from using this site. read our terms of service to learn more. by using our site you understand and agree to these terms. don't blame us... blame europe! this site uses cookies to store information on your computer which may track your browsing behavior on our site and provide you with ads or other offers that may be relevant to you. some are essential to make our site work; others help us improve the user experience. read our privacy policy to learn more. ripoff report | complaints reviews scams lawsuits frauds reported. file your review. consumers educating consumers.™ your account your profile your reports logout register login contact us update your ripoff report who is ed magedson – founder, ripoff report consumers say thank you in the media ripoff report investigates repair your reputation the right way programs & services corporate advocacy program - verified status guardian+ program - verified status verified status explained vip arbitration help & faqs faqs - general questions legal issues consumer resources verified business directory legal directory toggle navigation your profile your reports logout login register home update a report programs & services vip arbitration corporate advocacy program - verified status guardian+ program - verified status verified status explained help & faqs faqs - general questions legal issues contact us consumer resources verified business directory legal directory consumers say thank you in the media ripoff report investigates repair your reputation the right way who's crazy enough to start this website? by consumers, for consumers... don't let them get away with it!® let the truth be known!™ file a report ...it's free! review latest reports advanced search browse categories latest reports advanced search total visits since 1997 : 8,978,249,751+ estimated money consumers saved since 1997 : $15,711,937,064.79+ reports filed: 2,137,410+ update a report programs & services corporate advocacy program - verified status guardian+ program - verified status verified status explained vip arbitration help & faqs faqs - general questions legal issues contact us consumer resources verified business directory legal directory consumers say thank you in the media ripoff report investigates repair your reputation the right way corporate advocacy program repair your reputation the right way corporate advocacy program reputation management corporate advocacy program this is the best way to manage and repair your business reputation. hiding negative complaints is only a band-aid. consumers want to see how a business took care of business. all business will get complaints. how those businesses take care of those complaints is what separates good businesses from the rest. consumers love to do business with someone that can admit mistakes and state how they made improvements. corporate advocacy business remediation and customer satisfaction program. a program that benefits the consumer, assures them of complete satisfaction and confidence when doing business with a member business. get started home > search reports search by company, individual or report number: company name or report # search advanced search or browse latest reports 2,257,896 reports filed updated:07/21/2018 00:38:38 am mst corporate advocacy program ripoff report corporate advocacy business remediation & customer satisfaction program / consumer awareness videos ripoff report verified™ ... part of ripoff report corporate advocacy business remediation & customer satisfaction program. a program that benefits the consumer, assures them of complete satisfaction and confidence when doing business with a member business...yes, a long name for a program that does a lot for both consumers and businesses alike. successful corporate advocacy program members include: click names below, see how honest businesses have made a commitment to customer satisfaction dr lana rozenberg - serenity point recovery - towerpoint capital - sunlife solar victim of a consumer rip-off? want justice? ripoff report® is a worldwide consumer reporting web site and publication, by consumers, for consumers, to file and document complaints about companies or individuals. while we encourage and even require authors to only file truthful reports, ripoff report does not guarantee that all reports are authentic or accurate. be an educated consumer. read what you can and make your decision based upon an examination of all available information. unlike the better business bureau, ripoff report does not hide reports of "satisfied" complaints. all complaints remain public and unedited in order to create a working history on the company or individual in question. ripoff reports cover every category imaginable! you can browse the latest reports , search the reports, or submit your report now for free, by clicking on file report . by filing a ripoff report it's almost like creating your own web site ..and, it's free. your ripoff report will be discovered by millions of consumers! search engines will automatically discover most reports, meaning that within just a few days or weeks, your report may be found on search engines when consumers search, using key words relating to your ripoff report. helping you, the consumer... search the ripoff report before you do business with retail stores with bad return policies, checking & credit theft, rebate fraud or other unscrupulous business policies such as phony auto repairs, auto dealer bait-and-switch tactics, restaurants with bad service or food, corrupt government employees & politicians, police corruption, home builders, contractors, unethical doctors & lawyers, online stores that sell non-existent products, dead beat dads & moms, landlords & tenants, fraudulent employment & business opportunities, and individual con artists who scam consumers. filing a class action lawsuit & notifying the authorities many law firms and law enforcement agencies utilize ripoff report to aid in their investigations of business practices. by filing a report, your information may aid in pursing civil or criminal proceedings against companies engaged in wrongdoing. ripoff report has been contacted by almost every state attorney generals office, u.s. postal inspectors office, the justice department, homeland security, fbi, ftc and local and state authorities, including those in canada, uk, australia, and other government agencies around the world. media attention quite often the media is interested in the reports you filed and ask us to assist in their investigations giving you the publicity needed to help your cause. in the event your ripoff report is of interest to the media, we will put you in contact with them. we also supply story ideas along with victim information to every network and most local affiliates and to every major tv news magazine including dateline, 20/20, 48 hours, 60 minutes, inside edition, w2 canada, cnn, along with most major news papers including, ny times, wall street journal, forbes, money, inc. and hundreds of others. helping you, the reported business or individual my company has been reported! how do i respond? if you are a business with one or more reports filed against you, you can make it right. if handled correctly, ripoff report(s) filed against you can actually help improve your credibility and reputation. we offer you, for free, the opportunity to file a rebuttal to any report. (see the “rebuttal box™ | respond to this report!” at the top of the specific report you wish to comment on or the “respond to this report!” button at theend of the specific report you wish to comment on). every company receives complaints, but how they handle those complaints separates good business from the res

Analyse PopURL pour ripoffreport.com

https://www.ripoffreport.com/reports/specific_search/peoples+credit+first
https://www.ripoffreport.com/reports/specific_search/wells+fargo
https://www.ripoffreport.com/reports/trade-like-chuck/kearney-missouri-64060/trade-like-chuck-true-scam-trade-like-chuck-book-i-compared-against-my-system-his-is-terr-1359341
https://www.ripoffreport.com/reports/people-helping-people/lancaster-california-/people-helping-people-php-marketing-pyramid-scheme-scam-lies-insurance-rip-off-mlm-lancast-729541
https://www.ripoffreport.com/reports/specific_search/metro+pcs
https://www.ripoffreport.com/terms-of-service
https://www.ripoffreport.com/reports/fran-calista/internet/fran-calista-fran-calista-is-a-criminal-running-organized-cyber-crimes-that-includes-wire-1393151
https://www.ripoffreport.com/reports/western-governors-university/salt-lake-city-utah-84107-2533/western-governors-university-ripoff-dishonest-fraudulent-advertising-and-billing-salt-lak-205419
https://www.ripoffreport.com/verified
https://www.ripoffreport.com/reports/specific_search/cash+call
https://www.ripoffreport.com/reports/usa-fashion-factory/internet/usa-fashion-factory-i-ordered-a-pair-of-shoes-in-march-of-2017-after-waiting-the-alloted-1374893
https://www.ripoffreport.com/reports/tvc-marketing/oklahoma-city-oklahoma-73116/tvc-marketing-tvc-matrixmcamotor-club-of-america-false-advertisingnew-internet-scam-mor-986514
https://www.ripoffreport.com/reports/specific_search/lvaap
https://www.ripoffreport.com/reports/national-companies-team-national/davie-florida-33324/national-companies-team-national-beware-of-this-company-and-their-savings-scam-davie-f-596273
https://www.ripoffreport.com/reports/mobe/internet/mobemy-online-business-empiremttbmy-top-tier-business-scam-ponzi-pyramid-internet-1259517

Informations Whois

Whois est un protocole qui permet d'accéder aux informations d'enregistrement.Vous pouvez atteindre quand le site Web a été enregistré, quand il va expirer, quelles sont les coordonnées du site avec les informations suivantes. En un mot, il comprend ces informations;

Domain Name: RIPOFFREPORT.COM
Registry Domain ID: 3406735_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.directnic.com
Registrar URL: http://www.directnic.com
Updated Date: 2016-10-24T06:05:10Z
Creation Date: 1998-12-09T05:00:00Z
Registry Expiry Date: 2017-12-08T05:00:00Z
Registrar: DNC Holdings, Inc.
Registrar IANA ID: 291
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: ADEL.NS.CLOUDFLARE.COM
Name Server: AJAY.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-06T18:27:36Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  REGISTRAR DNC Holdings, Inc.

SERVERS

  SERVER com.whois-servers.net

  ARGS domain =ripoffreport.com

  PORT 43

  TYPE domain
RegrInfo
DOMAIN

  NAME ripoffreport.com

  CHANGED 2016-10-24

  CREATED 1998-12-09

STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited

NSERVER

  ADEL.NS.CLOUDFLARE.COM 173.245.58.55

  AJAY.NS.CLOUDFLARE.COM 173.245.59.56

  REGISTERED yes

Erreurs

La liste suivante vous montre les fautes d'orthographe possibles des internautes pour le site Web recherché.